Skip directly to search Skip directly to A to Z list Skip directly to page options Skip directly to site content

Volume 17, Number 12—December 2011

Research

Novel Multiplexed HIV/Simian Immunodeficiency Virus Antibody Detection Assay

Steve Ahuka-Mundeke, Ahidjo Ayouba, Placide Mbala-Kingebeni, Florian Liegeois, Amandine Esteban, Octavie Lunguya-Metila, Didace Demba, Guy Bilulu, Valentin Mbenzo-Abokome, Bila-Isia Inogwabini, Jean-Jacques Muyembe-Tamfum, Eric Delaporte, and Martine PeetersComments to Author 
Author affiliations: University of Montpellier, Montpellier, France (S. Ahuka-Mundeke, A. Ayouba, F. Liegeois, A. Esteban, E. Delaporte, M. Peeters); Institut National de Recherche Biomédicales, Kinshasa, Democratic Republic of Congo (S. Ahuka-Mundeke, P. Mbala-Kingebeni, O. Lunguya-Metila, J.-J. Muyembe-Tamfum); Cliniques Universitaires de Kinshasa, Kinshasa (S. Ahuka-Mundeke, P. Mbala-Kingebeni, O. Lunguya-Metila, J.-J. Muyembe-Tamfum); Zone de Santé de Kole, Sankuru, Kasai Oriental, Democratic Republic of Congo (D. Demba, G. Bilulu); World Wildlife Fund For Nature, Kinshasa (V. Mbenzo-Abokome, B-I. Inogwabini)

Main Article

Table 2

Amino acid sequences of the 34 SIV/HIV peptides used to develop the xMAP gp41 and V3-loop multiplex Luminex assay

Peptide SIV lineage gp41 peptide sequences V3-loop peptide sequences
HIV-1 M HIV1/SIVcpz/gor LAVERYLKDQQLLGIWGCSGKLIC NNTRKSVRIGPGQAFYATGDIIGDIRQAYC
HIV-1 O HIV1/SIVcpz/gor LALGTLIQNQQLLNLWGCKGKLIC NLTVQEIKIGPMAWYSMGLAAGNGSRAYC
HIV-1 N HIV1/SIVcpz/gor LAIGRYLRDQQILSLWGCSGKTIC NNTGGQVGIGPAMTFYNIGKIVGDIRKAYC
SIVcpzPts HIV1/SIVcpz/gor LAVEKYLRDQQLLSLWGCADKVTC NRTVRNLQIGPGMTFYNVEIATGDTRKAFC
SIVcpzPtt HIV1/SIVcpz/gor LAVERYLQDQQILGLWGCSGKAVC NNTRGEVQIGPGMTFYNIENVVGDTRSAYC
SIVgor HIV1/SIVcpz/gor LAIETYLRDQQLLGLWGCTGKLIC NNTRGQIQIGPMTIYNSERIIGNTRKAYC
HIV-2/SIVsmm HIV-2/SIVsmm TAIEKYLKDQAQLNSWGCAFRQVC GNKTVVPITLMSGLVFMSQPINKRPRQAWC
SIVrcm SIVrcm TAIEKYLADQSLLNTFGCAWRQVC SNRTVKGISLAIGVFISLRVEKRPKGAWC
SIVagm SIVagm TALEKYLEDQARLNAWGCAWKQVC GNKTVLPVTIMAGLVFHSQKYNTLLRQAWC
SIVgsn SIVgsn/mus/mon† SSLEKYLRDQTILQAWGCANRPIC GNKTIRNLQIGAGMTFYSQVIVGGNTRKAYC
SIVmus SIVgsn/mus/mon† TALEKFVKDQAILNLWGCANRQIC
SIVmon SIVgsn/mus/mon† TAVEKFIKDQTLLNAWGCANKAVC
SIVdeb SIVdeb TAIEKYLKDQAKLNEWGCAFKQIC GNKTYRAVHMATGLSFYTTFIPRLRIKRAHC
SIVtal SIVtal‡ TALEKYLEDQAKLNSWGCAWKQIC RTIKDLQIAAGLMFHSQIIAGKDLKRAY
SIVsyk SIVsyk TALETYLRDQAIMSNWGCAFKQIC GNESIKNIQLAAGYFLPVIQGKLKTGRDAKRAFC
SIVlho SIVlho/sun TAIEEYLKDQALLASWGCQWKQVC GNRSEVSTISSTGLLFYYGLEHGSRLRLAQC
SIVmnd-2 SIVmnd TALEDYVADQSRLAVWGCSFSQVC GNRSVVSTPSATGLLFYHLGPGKNLKKGMC
SIVwrc SIVwrc SAIEGFLEDQLKLKQWGCELTQVC GNRSVVSVNSASGLIYYAGLEPHRNIRKGLC
SIVcol SIVcol‡ ATIEGYLEEQAKLASIGCANMQIC GNSSHRNLNTANGAKFYYELIPYSKGIYGRC

*SIV, simian immunodeficiency virus.
†V3 amino acid sequences of SIVgsn, SIVmus, and SIVmon were identical, and only the SIVgsn above the V3-loop peptide was synthesized.
‡Synthesis of SIVcol gp41 and SIVtal V3-loop peptides was unsuccessful.

Main Article

TOP