Volume 24, Number 4—April 2018
Research
Cooperative Recognition of Internationally Disseminated Ceftriaxone-Resistant Neisseria gonorrhoeae Strain
Table 2
PenA types identified in ceftriaxone-resistant Neisseria gonorrhoeae strains*
| PenA type | Strain ID | Amino acid position in PenA protein (2,18) |
|---|---|---|
| 34711111222222222223333333333333333333333333344444444444444444444555555555555555555 51000467000013678891112222223333444445777788800011134456666677888001111344455555677 01403123440295811263467890125123563467836914702384882356903146251367323602367756 ↑ ↑ ↑ | ||
| 0 | M32091 | MCAKDDVNYGEDQQAADRRAIVAGTDLNERLQPSPR.SRGAEFEITLNRRPAVLQIFESRENPTTAFANVAAHGGAPPKII.A |
| 37 | H041 | ....E.ASHAGEE..VEKQVMPS.V.TTDTFL.ATQ.TMTPK.DVSV.K..VEVKVIA.KKEASI.LVY...N.ST.VQVVNV |
| 42 | F89 | ....E.ASHAGEE..VEKQ.MTS.V.ATDTFLSATQ.TMTPK.DV..S.QKVEVKVIA.KKEA..PLVY...N.S........ |
| 60 | FC428/ FC460/ A7536/ A7846/ 47707 | ...................VMTS.V.PTDTFL.ATQ.TMTPK.DV..S.QKVEVKVIA.KKEASI.LVY...N.ST.VQVVNV |
| 64 | A8806 | ....E.ASHAGEE......VMTS.V.PTDTFL.ATQ.TMTPK.DV..S.QKVEVKVIA.KKEASI.LVY...N.ST.VQVVNV |
*Arrows indicate key amino acid positions associated with high level β-lactam resistance. PenA, penicillin-binding protein 2.
References
- Ohnishi M, Saika T, Hoshina S, Iwasaku K, Nakayama S, Watanabe H, et al. Ceftriaxone-resistant Neisseria gonorrhoeae, Japan. Emerg Infect Dis. 2011;17:148–9. DOIPubMedGoogle Scholar
- Ohnishi M, Golparian D, Shimuta K, Saika T, Hoshina S, Iwasaku K, et al. Is Neisseria gonorrhoeae initiating a future era of untreatable gonorrhea?: detailed characterization of the first strain with high-level resistance to ceftriaxone. Antimicrob Agents Chemother. 2011;55:3538–45. DOIPubMedGoogle Scholar
- Unemo M, Golparian D, Nicholas R, Ohnishi M, Gallay A, Sednaoui P. High-level cefixime- and ceftriaxone-resistant Neisseria gonorrhoeae in France: novel penA mosaic allele in a successful international clone causes treatment failure. Antimicrob Agents Chemother. 2012;56:1273–80. DOIPubMedGoogle Scholar
- Cámara J, Serra J, Ayats J, Bastida T, Carnicer-Pont D, Andreu A, et al. Molecular characterization of two high-level ceftriaxone-resistant Neisseria gonorrhoeae isolates detected in Catalonia, Spain. J Antimicrob Chemother. 2012;67:1858–60. DOIPubMedGoogle Scholar
- Lahra MM, Ryder N, Whiley DM. A new multidrug-resistant strain of Neisseria gonorrhoeae in Australia. N Engl J Med. 2014;371:1850–1. DOIPubMedGoogle Scholar
- Deguchi T, Yasuda M, Hatazaki K, Kameyama K, Horie K, Kato T, et al. New clinical strain of Neisseria gonorrhoeae with decreased susceptibility to ceftriaxone, Japan. Emerg Infect Dis. 2016;22:142–4. DOIPubMedGoogle Scholar
- Nakayama S, Shimuta K, Furubayashi K, Kawahata T, Unemo M, Ohnishi M. New ceftriaxone- and multidrug-resistant Neisseria gonorrhoeae strain with a novel mosaic penA gene isolated in Japan. Antimicrob Agents Chemother. 2016;60:4339–41. DOIPubMedGoogle Scholar
- Lefebvre B, Martin I, Demczuk W, Deshaies L, Michaud S, Labbé AC, et al. Ceftriaxone-Resistant Neisseria gonorrhoeae, Canada, 2017. Emerg Infect Dis. 2018;24:381–3. DOIPubMedGoogle Scholar
- Terkelsen D, Tolstrup J, Hundahl Johnsen C, Lund O, Kiellberg Larsen H, Worning P, et al. Multidrug-resistant Neisseria gonorrhoeae infection with ceftriaxone resistance and intermediate resistance to azithromycin, Denmark, 2017. Euro Surveill. 2017;22:42. DOIPubMedGoogle Scholar
- Unemo M, Golparian D, Sánchez-Busó L, Grad Y, Jacobsson S, Ohnishi M, et al. The novel 2016 WHO Neisseria gonorrhoeae reference strains for global quality assurance of laboratory investigations: phenotypic, genetic and reference genome characterization. J Antimicrob Chemother. 2016;71:3096–108. DOIPubMedGoogle Scholar
- Clinical and Laboratory Standards Institute. Methods for dilution antimicrobial susceptibility tests for bacteria that grow aerobically; approved standard, 10th edition (M07–A10). Wayne (PA): The Institute; 2015.
- Clinical and Laboratory Standards Institute. Performance standards for antimicrobial susceptibility testing: twenty-seventh informational supplement (M100–S27). Wayne (PA): The Institute; 2017.
- European Committee on Antimicrobial Susceptibility Testing. Breakpoint tables for the interpretation of MICs and zone diameters. 2017 [cited 2017 Oct 12]. http://www.eucast.org/clinical_breakpoints/
- Demczuk W, Lynch T, Martin I, Van Domselaar G, Graham M, Bharat A, et al. Whole-genome phylogenomic heterogeneity of Neisseria gonorrhoeae isolates with decreased cephalosporin susceptibility collected in Canada between 1989 and 2013. J Clin Microbiol. 2015;53:191–200. DOIPubMedGoogle Scholar
- Bankevich A, Nurk S, Antipov D, Gurevich AA, Dvorkin M, Kulikov AS, et al. SPAdes: a new genome assembly algorithm and its applications to single-cell sequencing. J Comput Biol. 2012;19:455–77. DOIPubMedGoogle Scholar
- Seemann T. Prokka: rapid prokaryotic genome annotation. Bioinformatics. 2014;30:2068–9. DOIPubMedGoogle Scholar
- Petkau A, Mabon P, Sieffert C, Knox NC, Cabral J, Iskander M, et al. SNVPhyl: a single nucleotide variant phylogenomics pipeline for microbial genomic epidemiology. Microb Genom. 2017;3:e000116.PubMedGoogle Scholar
- Martin IMC, Ison CA, Aanensen DM, Fenton KA, Spratt BG. Rapid sequence-based identification of gonococcal transmission clusters in a large metropolitan area. J Infect Dis. 2004;189:1497–505. DOIPubMedGoogle Scholar
- Jolley KA, Maiden MCJ. BIGSdb: Scalable analysis of bacterial genome variation at the population level. BMC Bioinformatics. 2010;11:595. DOIPubMedGoogle Scholar
- Demczuk W, Sidhu S, Unemo M, Whiley DM, Allen VG, Dillon JR, et al. Neisseria gonorrhoeae sequence typing for antimicrobial resistance, a novel antimicrobial resistance multilocus typing scheme for tracking global dissemination of N. gonorrhoeae strains. J Clin Microbiol. 2017;55:1454–68. DOIPubMedGoogle Scholar
- World Health Organization. Report on global sexually transmitted infection surveillance 2015 Geneva: The Organization. 2016 [cited 16 Jan 2018]. http://apps.who.int/iris/bitstream/10665/249553/1/9789241565301-eng.pdf?ua=1
- Newman L, Rowley J, Vander Hoorn S, Wijesooriya NS, Unemo M, Low N, et al. Global estimates of the prevalence and incidence of four curable sexually transmitted infections in 2012 based on systematic review and global reporting. PLoS One. 2015;10:e0143304. DOIPubMedGoogle Scholar
- Chisholm SA, Mouton JW, Lewis DA, Nichols T, Ison CA, Livermore DM. Cephalosporin MIC creep among gonococci: time for a pharmacodynamic rethink? J Antimicrob Chemother. 2010;65:2141–8. DOIPubMedGoogle Scholar
- Martin I, Sawatzky P, Liu G, Allen V, Lefebvre B, Hoang L, et al. Decline in decreased cephalosporin susceptibility and increase in azithromycin resistance in Neisseria gonorrhoeae, Canada. Emerg Infect Dis. 2016;22:65–7. DOIPubMedGoogle Scholar
- Wi T, Lahra MM, Ndowa F, Bala M, Dillon JR, Ramon-Pardo P, et al. Antimicrobial resistance in Neisseria gonorrhoeae: Global surveillance and a call for international collaborative action. PLoS Med. 2017;14:e1002344. DOIPubMedGoogle Scholar
Page created: March 19, 2018
Page updated: March 19, 2018
Page reviewed: March 19, 2018
The conclusions, findings, and opinions expressed by authors contributing to this journal do not necessarily reflect the official position of the U.S. Department of Health and Human Services, the Public Health Service, the Centers for Disease Control and Prevention, or the authors' affiliated institutions. Use of trade names is for identification only and does not imply endorsement by any of the groups named above.